Lineage for d3notc2 (3not C:118-309)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970135Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2970136Family d.110.2.1: GAF domain [55782] (8 proteins)
  6. 2970141Protein Bacteriophytochrome BphP [160661] (3 species)
  7. 2970153Species Pseudomonas aeruginosa [TaxId:287] [160662] (5 PDB entries)
    Uniprot Q9HWR3 118-309
  8. 2970170Domain d3notc2: 3not C:118-309 [214026]
    Other proteins in same PDB: d3notc1, d3notc3
    automated match to d3c2wa1
    complexed with bla

Details for d3notc2

PDB Entry: 3not (more details), 2.7 Å

PDB Description: light-induced intermediate structure l2 of p. aeruginosa bacteriophytochrome
PDB Compounds: (C:) Bacteriophytochrome

SCOPe Domain Sequences for d3notc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3notc2 d.110.2.1 (C:118-309) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]}
lsitsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaes
rredlesylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsy
svlrsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsq
vcsaiverleqg

SCOPe Domain Coordinates for d3notc2:

Click to download the PDB-style file with coordinates for d3notc2.
(The format of our PDB-style files is described here.)

Timeline for d3notc2: