Lineage for d3notc1 (3not C:4-117)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1427772Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1427979Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 1428155Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins)
    Pfam PF08446; PAS_2
  6. 1428156Protein Bacteriophytochrome BphP [160672] (2 species)
  7. 1428161Species Pseudomonas aeruginosa [TaxId:287] [160674] (4 PDB entries)
    Uniprot Q9HWR3 5-117
  8. 1428170Domain d3notc1: 3not C:4-117 [214025]
    Other proteins in same PDB: d3notc2, d3notc3
    automated match to d3c2wa3
    complexed with bla

Details for d3notc1

PDB Entry: 3not (more details), 2.7 Å

PDB Description: light-induced intermediate structure l2 of p. aeruginosa bacteriophytochrome
PDB Compounds: (C:) Bacteriophytochrome

SCOPe Domain Sequences for d3notc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3notc1 d.110.3.9 (C:4-117) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]}
itpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsyltqeq
vgpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadt

SCOPe Domain Coordinates for d3notc1:

Click to download the PDB-style file with coordinates for d3notc1.
(The format of our PDB-style files is described here.)

Timeline for d3notc1: