Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins) Pfam PF08446; PAS_2 |
Protein Bacteriophytochrome BphP [160672] (2 species) |
Species Pseudomonas aeruginosa [TaxId:287] [160674] (4 PDB entries) Uniprot Q9HWR3 5-117 |
Domain d3notc1: 3not C:4-117 [214025] Other proteins in same PDB: d3notc2, d3notc3 automated match to d3c2wa3 complexed with bla |
PDB Entry: 3not (more details), 2.7 Å
SCOPe Domain Sequences for d3notc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3notc1 d.110.3.9 (C:4-117) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]} itpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsyltqeq vgpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadt
Timeline for d3notc1: