Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Anti-prion Fab 3F4, (mouse), kappa L chain [49098] (2 PDB entries) |
Domain d1cu4l2: 1cu4 L:108-214 [21402] Other proteins in same PDB: d1cu4h1, d1cu4l1 |
PDB Entry: 1cu4 (more details), 2.9 Å
SCOP Domain Sequences for d1cu4l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cu4l2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Anti-prion Fab 3F4, (mouse), kappa L chain} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1cu4l2: