Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries) |
Domain d1cr9h2: 1cr9 H:111-213 [21401] Other proteins in same PDB: d1cr9h1, d1cr9l1, d1cr9l2 part of anti-prion Fab 3F4 |
PDB Entry: 1cr9 (more details), 2 Å
SCOP Domain Sequences for d1cr9h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cr9h2 b.1.1.2 (H:111-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprvts
Timeline for d1cr9h2: