Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
Species Anti-prion Fab 3F4, (mouse), kappa L chain [49098] (2 PDB entries) |
Domain d1cr9h2: 1cr9 H:111-213 [21401] Other proteins in same PDB: d1cr9h1, d1cr9l1 |
PDB Entry: 1cr9 (more details), 2 Å
SCOP Domain Sequences for d1cr9h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cr9h2 b.1.1.2 (H:111-213) Immunoglobulin (constant domains of L and H chains) {Anti-prion Fab 3F4, (mouse), kappa L chain} akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprvts
Timeline for d1cr9h2: