Lineage for d1cr9l2 (1cr9 L:108-214)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365639Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 365760Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)
  8. 365803Domain d1cr9l2: 1cr9 L:108-214 [21400]
    Other proteins in same PDB: d1cr9h1, d1cr9h2, d1cr9l1
    part of anti-prion Fab 3F4

Details for d1cr9l2

PDB Entry: 1cr9 (more details), 2 Å

PDB Description: crystal structure of the anti-prion fab 3f4

SCOP Domain Sequences for d1cr9l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cr9l2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1cr9l2:

Click to download the PDB-style file with coordinates for d1cr9l2.
(The format of our PDB-style files is described here.)

Timeline for d1cr9l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cr9l1