SCOPe 2.05: Domain d3nkta_: 3nkt A:

Lineage for d3nkta_ (3nkt A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.23: Gentisate 1,2-dioxygenase-like [159299] (2 proteins)
   Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin; homotetramer

6. Protein automated matches [190924] (1 species)
   not a true protein

7. Species Pseudaminobacter salicylatoxidans [TaxId:93369] [188421] (10 PDB entries)

8. Domain d3nkta_: 3nkt A: [213995]
   automated match to d3nl1a_
   complexed with 1hn, fe2, gol

Details for d3nkta_

PDB Entry: 3nkt, 2.35 Å

PDB Description: Crystal Structure of Salicylate 1,2-dioxygenase from Pseudoaminobacter salicylatoxidans Adducts with naphthoate

PDB Compounds: (A:) Gentisate 1,2-dioxygenase

SCOPe Domain Sequences for d3nkta_:

Sequence; same for both SEQRES and ATOM records:

>d3nkta_ b.82.1.23 (A:) automated matches {Pseudaminobacter salicylatoxidans [TaxId: 93369]}
ekldhesvtqamqpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwkwst
llrlarksgelvpvgrggerralglanpglggnayisptmwagiqylgpretapehrhsq
nafrfvvegegvwtvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipfsqq
mdvgffefgsdrvtdyatpnfsrgerlwchpglrplsglqntvaspigayrweftdralt
eqllledegqpatvapghaairyvnpttggdvmptlrcefhrlragtetatrnevgstvf
qvfegagavvmngettklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfmrtk
iegq

Timeline for d3nkta_:

• d3nkta_ first appeared in SCOPe 2.03
  
• d3nkta_ appears in SCOPe 2.04
  
• d3nkta_ appears in SCOPe 2.06
  
• d3nkta_ appears in the current release, SCOPe 2.08