Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (81 species) not a true protein |
Species Rhodobacter capsulatus [TaxId:272942] [226150] (1 PDB entry) |
Domain d3njra1: 3njr A:1-183 [213992] Other proteins in same PDB: d3njra2, d3njrb2 automated match to d3e05h_ complexed with gol, pg4, sah |
PDB Entry: 3njr (more details), 2.7 Å
SCOPe Domain Sequences for d3njra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3njra1 c.66.1.0 (A:1-183) automated matches {Rhodobacter capsulatus [TaxId: 272942]} sqvpgrpesafahdgqitkspmraltlaalaprrgellwdigggsgsvsvewclaggrai tiepradrieniqknidtyglsprmravqgtapaaladlplpeavfiggggsqalydrlw ewlapgtrivanavtlesetlltqlharhggqllridiaqaeplgrmrgwsasrpqlqws gqr
Timeline for d3njra1: