Lineage for d1ejoh2 (1ejo H:2620-2719)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549177Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)
  8. 549362Domain d1ejoh2: 1ejo H:2620-2719 [21399]
    Other proteins in same PDB: d1ejoh1, d1ejol1, d1ejol2
    part of anti-FMDV Fab 4C4

Details for d1ejoh2

PDB Entry: 1ejo (more details), 2.3 Å

PDB Description: fab fragment of neutralising monoclonal antibody 4c4 complexed with g- h loop from fmdv.

SCOP Domain Sequences for d1ejoh2:

Sequence, based on SEQRES records: (download)

>d1ejoh2 b.1.1.2 (H:2620-2719) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplapvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records): (download)

>d1ejoh2 b.1.1.2 (H:2620-2719) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplapvcgsvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls
ssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1ejoh2:

Click to download the PDB-style file with coordinates for d1ejoh2.
(The format of our PDB-style files is described here.)

Timeline for d1ejoh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ejoh1