Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (71 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [225553] (2 PDB entries) |
Domain d3nhzd_: 3nhz D: [213982] automated match to d2iyna_ complexed with mg |
PDB Entry: 3nhz (more details), 2.5 Å
SCOPe Domain Sequences for d3nhzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nhzd_ c.23.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} mrqrilvvdddaslaemltivlrgegfdtavigdgtqaltavrelrpdlvlldlmlpgmn gidvcrvlradsgvpivmltaktdtvdvvlglesgaddyimkpfkpkelvarvrarlr
Timeline for d3nhzd_: