SCOPe 2.06: Domain d3nhzd_: 3nhz D:

Lineage for d3nhzd_ (3nhz D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [225553] (2 PDB entries)

8. Domain d3nhzd_: 3nhz D: [213982]
   automated match to d2iyna_
   complexed with mg

Details for d3nhzd_

PDB Entry: 3nhz, 2.5 Å

PDB Description: Structure of N-terminal Domain of MtrA

PDB Compounds: (D:) Two component system transcriptional regulator mtrA

SCOPe Domain Sequences for d3nhzd_:

Sequence; same for both SEQRES and ATOM records:

>d3nhzd_ c.23.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mrqrilvvdddaslaemltivlrgegfdtavigdgtqaltavrelrpdlvlldlmlpgmn
gidvcrvlradsgvpivmltaktdtvdvvlglesgaddyimkpfkpkelvarvrarlr

Timeline for d3nhzd_:

• d3nhzd_ first appeared in SCOPe 2.03
  
• d3nhzd_ appears in SCOPe 2.05
  
• d3nhzd_ appears in SCOPe 2.07
  
• d3nhzd_ appears in the current release, SCOPe 2.08