Lineage for d1ejol2 (1ejo L:2112-2216)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453918Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 454044Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)
  8. 454217Domain d1ejol2: 1ejo L:2112-2216 [21398]
    Other proteins in same PDB: d1ejoh1, d1ejoh2, d1ejol1
    part of anti-FMDV Fab 4C4

Details for d1ejol2

PDB Entry: 1ejo (more details), 2.3 Å

PDB Description: fab fragment of neutralising monoclonal antibody 4c4 complexed with g- h loop from fmdv.

SCOP Domain Sequences for d1ejol2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejol2 b.1.1.2 (L:2112-2216) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

SCOP Domain Coordinates for d1ejol2:

Click to download the PDB-style file with coordinates for d1ejol2.
(The format of our PDB-style files is described here.)

Timeline for d1ejol2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ejol1