Lineage for d3nhqf1 (3nhq F:5-117)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970589Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins)
    Pfam PF08446; PAS_2
  6. 2970590Protein Bacteriophytochrome BphP [160672] (3 species)
  7. 2970597Species Pseudomonas aeruginosa [TaxId:287] [160674] (7 PDB entries)
    Uniprot Q9HWR3 5-117
  8. 2970603Domain d3nhqf1: 3nhq F:5-117 [213970]
    Other proteins in same PDB: d3nhqa2, d3nhqa3, d3nhqb2, d3nhqb3, d3nhqc2, d3nhqc3, d3nhqd2, d3nhqd3, d3nhqe2, d3nhqe3, d3nhqf2, d3nhqf3, d3nhqf4, d3nhqg2, d3nhqg3, d3nhqh2, d3nhqh3
    automated match to d3c2wa3
    complexed with bla

Details for d3nhqf1

PDB Entry: 3nhq (more details), 2.55 Å

PDB Description: The dark Pfr structure of the photosensory core module of P. aeruginosa Bacteriophytochrome
PDB Compounds: (F:) Bacteriophytochrome

SCOPe Domain Sequences for d3nhqf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nhqf1 d.110.3.9 (F:5-117) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]}
tpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsyltqeqv
gpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadt

SCOPe Domain Coordinates for d3nhqf1:

Click to download the PDB-style file with coordinates for d3nhqf1.
(The format of our PDB-style files is described here.)

Timeline for d3nhqf1: