Lineage for d3nhqe3 (3nhq E:310-495)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970135Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2970232Family d.110.2.4: Phytochrome-specific domain [160664] (2 proteins)
    Pfam PF00360
  6. 2970233Protein Bacteriophytochrome BphP [160665] (1 species)
  7. 2970234Species Pseudomonas aeruginosa [TaxId:287] [160666] (4 PDB entries)
    Uniprot Q9HWR3 310-494
  8. 2970239Domain d3nhqe3: 3nhq E:310-495 [213969]
    Other proteins in same PDB: d3nhqa1, d3nhqa2, d3nhqb1, d3nhqb2, d3nhqc1, d3nhqc2, d3nhqd1, d3nhqd2, d3nhqe1, d3nhqe2, d3nhqf1, d3nhqf2, d3nhqf4, d3nhqg1, d3nhqg2, d3nhqh1, d3nhqh2
    automated match to d3c2wa2
    complexed with bla

Details for d3nhqe3

PDB Entry: 3nhq (more details), 2.55 Å

PDB Description: The dark Pfr structure of the photosensory core module of P. aeruginosa Bacteriophytochrome
PDB Compounds: (E:) Bacteriophytochrome

SCOPe Domain Sequences for d3nhqe3:

Sequence, based on SEQRES records: (download)

>d3nhqe3 d.110.2.4 (E:310-495) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]}
riaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlggrtlsirgd
ferqagnvlqrlqrdperdiyhtdnwpqpsedspdggdccgvlairfhrqesgwifwfrh
eevhrirwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdlaiaeklrldl
melcln

Sequence, based on observed residues (ATOM records): (download)

>d3nhqe3 d.110.2.4 (E:310-495) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]}
riaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlggrtlsirgd
ferqagnvlqrlqrdperdiyhtdnwccgvlairfhrqesgwifwfrheevhrirwggkp
eklltigpsgprltprgsfeaweevvrghstpwsetdlaiaeklrldlmelcln

SCOPe Domain Coordinates for d3nhqe3:

Click to download the PDB-style file with coordinates for d3nhqe3.
(The format of our PDB-style files is described here.)

Timeline for d3nhqe3: