Lineage for d3nhqe2 (3nhq E:118-309)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970135Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2970136Family d.110.2.1: GAF domain [55782] (8 proteins)
  6. 2970141Protein Bacteriophytochrome BphP [160661] (3 species)
  7. 2970153Species Pseudomonas aeruginosa [TaxId:287] [160662] (5 PDB entries)
    Uniprot Q9HWR3 118-309
  8. 2970158Domain d3nhqe2: 3nhq E:118-309 [213968]
    Other proteins in same PDB: d3nhqa1, d3nhqa3, d3nhqb1, d3nhqb3, d3nhqc1, d3nhqc3, d3nhqd1, d3nhqd3, d3nhqe1, d3nhqe3, d3nhqf1, d3nhqf3, d3nhqf4, d3nhqg1, d3nhqg3, d3nhqh1, d3nhqh3
    automated match to d3c2wa1
    complexed with bla

Details for d3nhqe2

PDB Entry: 3nhq (more details), 2.55 Å

PDB Description: The dark Pfr structure of the photosensory core module of P. aeruginosa Bacteriophytochrome
PDB Compounds: (E:) Bacteriophytochrome

SCOPe Domain Sequences for d3nhqe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nhqe2 d.110.2.1 (E:118-309) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]}
lsitsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaes
rredlesylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsy
svlrsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsq
vcsaiverleqg

SCOPe Domain Coordinates for d3nhqe2:

Click to download the PDB-style file with coordinates for d3nhqe2.
(The format of our PDB-style files is described here.)

Timeline for d3nhqe2: