| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.2: GAF domain-like [55781] (5 families) ![]() alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
| Family d.110.2.1: GAF domain [55782] (8 proteins) |
| Protein Bacteriophytochrome BphP [160661] (3 species) |
| Species Pseudomonas aeruginosa [TaxId:287] [160662] (5 PDB entries) Uniprot Q9HWR3 118-309 |
| Domain d3nhqd2: 3nhq D:118-309 [213965] Other proteins in same PDB: d3nhqa1, d3nhqa3, d3nhqb1, d3nhqb3, d3nhqc1, d3nhqc3, d3nhqd1, d3nhqd3, d3nhqe1, d3nhqe3, d3nhqf1, d3nhqf3, d3nhqf4, d3nhqg1, d3nhqg3, d3nhqh1, d3nhqh3 automated match to d3c2wa1 complexed with bla |
PDB Entry: 3nhq (more details), 2.55 Å
SCOPe Domain Sequences for d3nhqd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nhqd2 d.110.2.1 (D:118-309) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]}
lsitsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaes
rredlesylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsy
svlrsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsq
vcsaiverleqg
Timeline for d3nhqd2: