SCOPe 2.08: Domain d3nhqd1: 3nhq D:5-117

Lineage for d3nhqd1 (3nhq D:5-117)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins)
   Pfam PF08446; PAS_2

6. Protein Bacteriophytochrome BphP [160672] (3 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [160674] (7 PDB entries)
   Uniprot Q9HWR3 5-117

8. Domain d3nhqd1: 3nhq D:5-117 [213964]
   Other proteins in same PDB: d3nhqa2, d3nhqa3, d3nhqb2, d3nhqb3, d3nhqc2, d3nhqc3, d3nhqd2, d3nhqd3, d3nhqe2, d3nhqe3, d3nhqf2, d3nhqf3, d3nhqf4, d3nhqg2, d3nhqg3, d3nhqh2, d3nhqh3
   automated match to d3c2wa3
   complexed with bla

Details for d3nhqd1

PDB Entry: 3nhq, 2.55 Å

PDB Description: The dark Pfr structure of the photosensory core module of P. aeruginosa Bacteriophytochrome

PDB Compounds: (D:) Bacteriophytochrome

SCOPe Domain Sequences for d3nhqd1:

Sequence; same for both SEQRES and ATOM records:

>d3nhqd1 d.110.3.9 (D:5-117) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]}
tpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsyltqeqv
gpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadt

Timeline for d3nhqd1:

• d3nhqd1 first appeared in SCOPe 2.03
  
• d3nhqd1 appears in SCOPe 2.07