| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
| Protein automated matches [190131] (86 species) not a true protein |
| Species Myxococcus xanthus [TaxId:246197] [225930] (1 PDB entry) |
| Domain d3nhma_: 3nhm A: [213951] automated match to d3t6ka_ |
PDB Entry: 3nhm (more details), 2.19 Å
SCOPe Domain Sequences for d3nhma_:
Sequence, based on SEQRES records: (download)
>d3nhma_ c.23.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 246197]}
pkvlivenswtmretlrlllsgefdcttaadgasglqqalahppdvlisdvnmdgmdgya
lcghfrseptlkhipvifvsgyaprtegpadqpvpdaylvkpvkppvliaqlhallarae
>d3nhma_ c.23.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 246197]}
pkvlivenswtmretlrlllsgefdcttaadgasglqqalahppdvlisdvnmdgmdgya
lcghfrseptlkhipvifvsgyapadqpvpdaylvkpvkppvliaqlhallarae
Timeline for d3nhma_: