Lineage for d3nhma_ (3nhm A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856037Species Myxococcus xanthus [TaxId:246197] [225930] (1 PDB entry)
  8. 2856038Domain d3nhma_: 3nhm A: [213951]
    automated match to d3t6ka_

Details for d3nhma_

PDB Entry: 3nhm (more details), 2.19 Å

PDB Description: crystal structure of a response regulator from myxococcus xanthus
PDB Compounds: (A:) Response regulator

SCOPe Domain Sequences for d3nhma_:

Sequence, based on SEQRES records: (download)

>d3nhma_ c.23.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 246197]}
pkvlivenswtmretlrlllsgefdcttaadgasglqqalahppdvlisdvnmdgmdgya
lcghfrseptlkhipvifvsgyaprtegpadqpvpdaylvkpvkppvliaqlhallarae

Sequence, based on observed residues (ATOM records): (download)

>d3nhma_ c.23.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 246197]}
pkvlivenswtmretlrlllsgefdcttaadgasglqqalahppdvlisdvnmdgmdgya
lcghfrseptlkhipvifvsgyapadqpvpdaylvkpvkppvliaqlhallarae

SCOPe Domain Coordinates for d3nhma_:

Click to download the PDB-style file with coordinates for d3nhma_.
(The format of our PDB-style files is described here.)

Timeline for d3nhma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3nhmb_