SCOPe 2.06: Domain d3nh7o1: 3nh7 O:2-109

Lineage for d3nh7o1 (3nh7 O:2-109)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d3nh7o1: 3nh7 O:2-109 [213949]
   Other proteins in same PDB: d3nh7a_, d3nh7b_, d3nh7c_, d3nh7d_
   automated match to d1h0da1

Details for d3nh7o1

PDB Entry: 3nh7, 2.7 Å

PDB Description: Crystal structure of the neutralizing Fab fragment AbD1556 bound to the BMP type I receptor IA

PDB Compounds: (O:) Antibody fragment Fab AbD1556, light chain

SCOPe Domain Sequences for d3nh7o1:

Sequence; same for both SEQRES and ATOM records:

>d3nh7o1 b.1.1.0 (O:2-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ieltqppsvsvapgqtariscsgdslgskyviwyqqkpgqapvlviyddsnrpsgiperf
sgsnsgntatltisgtqaedeadyycstftmsgngtvfgggtkltvlg

Timeline for d3nh7o1:

• d3nh7o1 first appeared in SCOPe 2.03
  
• d3nh7o1 appears in SCOPe 2.05
  
• d3nh7o1 appears in SCOPe 2.07
  
• d3nh7o1 appears in the current release, SCOPe 2.08