Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d3nh7n1: 3nh7 N:2-109 [213947] Other proteins in same PDB: d3nh7a_, d3nh7b_, d3nh7c_, d3nh7d_ automated match to d1h0da1 |
PDB Entry: 3nh7 (more details), 2.7 Å
SCOPe Domain Sequences for d3nh7n1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nh7n1 b.1.1.0 (N:2-109) automated matches {Human (Homo sapiens) [TaxId: 9606]} ieltqppsvsvapgqtariscsgdslgskyviwyqqkpgqapvlviyddsnrpsgiperf sgsnsgntatltisgtqaedeadyycstftmsgngtvfgggtkltvlg
Timeline for d3nh7n1: