Lineage for d3nh7l1 (3nh7 L:2-109)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1766184Domain d3nh7l1: 3nh7 L:2-109 [213943]
    Other proteins in same PDB: d3nh7a_, d3nh7b_, d3nh7c_, d3nh7d_
    automated match to d1h0da1

Details for d3nh7l1

PDB Entry: 3nh7 (more details), 2.7 Å

PDB Description: Crystal structure of the neutralizing Fab fragment AbD1556 bound to the BMP type I receptor IA
PDB Compounds: (L:) Antibody fragment Fab AbD1556, light chain

SCOPe Domain Sequences for d3nh7l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nh7l1 b.1.1.0 (L:2-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ieltqppsvsvapgqtariscsgdslgskyviwyqqkpgqapvlviyddsnrpsgiperf
sgsnsgntatltisgtqaedeadyycstftmsgngtvfgggtkltvlg

SCOPe Domain Coordinates for d3nh7l1:

Click to download the PDB-style file with coordinates for d3nh7l1.
(The format of our PDB-style files is described here.)

Timeline for d3nh7l1: