SCOPe 2.05: Domain d3ngxb1: 3ngx B:2-115

Lineage for d3ngxb1 (3ngx B:2-115)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (23 species)
   not a true protein

7. Species Thermoplasma acidophilum [TaxId:2303] [226113] (2 PDB entries)

8. Domain d3ngxb1: 3ngx B:2-115 [213941]
   Other proteins in same PDB: d3ngxa2, d3ngxb2
   automated match to d1a4ia2

Details for d3ngxb1

PDB Entry: 3ngx, 2.3 Å

PDB Description: crystal structure of bifunctional 5,10-methylenetetrahydrofolate dehydrogenase / cyclohydrolase from thermoplasma acidophilum

PDB Compounds: (B:) Bifunctional protein folD

SCOPe Domain Sequences for d3ngxb1:

Sequence; same for both SEQRES and ATOM records:

>d3ngxb1 c.58.1.0 (B:2-115) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
kilrgeeiaekkaenlhgiiersglepslkliqigdneaasiyarakirrgkkigiavdl
ekyddismkdllkriddlakdpqingimienplpkgfdyyeivrnipyykdvda

Timeline for d3ngxb1:

• d3ngxb1 first appeared in SCOPe 2.03
  
• d3ngxb1 appears in SCOPe 2.04
  
• d3ngxb1 appears in SCOPe 2.06
  
• d3ngxb1 appears in the current release, SCOPe 2.08