Lineage for d3ngxb1 (3ngx B:2-115)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1610013Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 1610014Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 1610318Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 1610319Protein automated matches [226864] (21 species)
    not a true protein
  7. 1610438Species Thermoplasma acidophilum [TaxId:2303] [226113] (2 PDB entries)
  8. 1610440Domain d3ngxb1: 3ngx B:2-115 [213941]
    Other proteins in same PDB: d3ngxa2, d3ngxb2
    automated match to d1a4ia2

Details for d3ngxb1

PDB Entry: 3ngx (more details), 2.3 Å

PDB Description: crystal structure of bifunctional 5,10-methylenetetrahydrofolate dehydrogenase / cyclohydrolase from thermoplasma acidophilum
PDB Compounds: (B:) Bifunctional protein folD

SCOPe Domain Sequences for d3ngxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ngxb1 c.58.1.0 (B:2-115) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
kilrgeeiaekkaenlhgiiersglepslkliqigdneaasiyarakirrgkkigiavdl
ekyddismkdllkriddlakdpqingimienplpkgfdyyeivrnipyykdvda

SCOPe Domain Coordinates for d3ngxb1:

Click to download the PDB-style file with coordinates for d3ngxb1.
(The format of our PDB-style files is described here.)

Timeline for d3ngxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ngxb2