| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
| Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
| Protein automated matches [226864] (38 species) not a true protein |
| Species Thermoplasma acidophilum [TaxId:2303] [226113] (2 PDB entries) |
| Domain d3ngxa1: 3ngx A:2-115 [213939] Other proteins in same PDB: d3ngxa2, d3ngxb2 automated match to d1a4ia2 |
PDB Entry: 3ngx (more details), 2.3 Å
SCOPe Domain Sequences for d3ngxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ngxa1 c.58.1.0 (A:2-115) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
kilrgeeiaekkaenlhgiiersglepslkliqigdneaasiyarakirrgkkigiavdl
ekyddismkdllkriddlakdpqingimienplpkgfdyyeivrnipyykdvda
Timeline for d3ngxa1: