Lineage for d3nglc2 (3ngl C:116-275)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848817Species Thermoplasma acidophilum [TaxId:2303] [187636] (6 PDB entries)
  8. 2848827Domain d3nglc2: 3ngl C:116-275 [213938]
    Other proteins in same PDB: d3ngla1, d3nglc1
    automated match to d1a4ia1
    complexed with nap

Details for d3nglc2

PDB Entry: 3ngl (more details), 2.4 Å

PDB Description: crystal structure of bifunctional 5,10-methylenetetrahydrofolate dehydrogenase / cyclohydrolase from thermoplasma acidophilum
PDB Compounds: (C:) Bifunctional protein folD

SCOPe Domain Sequences for d3nglc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nglc2 c.2.1.0 (C:116-275) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
lspynqglialnreflvpatpravidimdyygyhentvtivnrspvvgrplsmmllnrny
tvsvchsktkdigsmtrsskivvvavgrpgflnremvtpgsvvidvginyvndkvvgdan
fedlseyveaitpvpggvgpitatnilenvvkaaefqknn

SCOPe Domain Coordinates for d3nglc2:

Click to download the PDB-style file with coordinates for d3nglc2.
(The format of our PDB-style files is described here.)

Timeline for d3nglc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nglc1