Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Thermoplasma acidophilum [TaxId:2303] [187636] (6 PDB entries) |
Domain d3nglc2: 3ngl C:116-275 [213938] Other proteins in same PDB: d3ngla1, d3nglc1 automated match to d1a4ia1 complexed with nap |
PDB Entry: 3ngl (more details), 2.4 Å
SCOPe Domain Sequences for d3nglc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nglc2 c.2.1.0 (C:116-275) automated matches {Thermoplasma acidophilum [TaxId: 2303]} lspynqglialnreflvpatpravidimdyygyhentvtivnrspvvgrplsmmllnrny tvsvchsktkdigsmtrsskivvvavgrpgflnremvtpgsvvidvginyvndkvvgdan fedlseyveaitpvpggvgpitatnilenvvkaaefqknn
Timeline for d3nglc2: