Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
Protein automated matches [226864] (40 species) not a true protein |
Species Thermoplasma acidophilum [TaxId:2303] [226113] (2 PDB entries) |
Domain d3nglc1: 3ngl C:2-115 [213937] Other proteins in same PDB: d3ngla2, d3nglc2 automated match to d1a4ia2 complexed with nap |
PDB Entry: 3ngl (more details), 2.4 Å
SCOPe Domain Sequences for d3nglc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nglc1 c.58.1.0 (C:2-115) automated matches {Thermoplasma acidophilum [TaxId: 2303]} kilrgeeiaekkaenlhgiiersglepslkliqigdneaasiyarakirrgkkigiavdl ekyddismkdllkriddlakdpqingimienplpkgfdyyeivrnipyykdvda
Timeline for d3nglc1: