Lineage for d3nglc1 (3ngl C:2-115)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 2890855Species Thermoplasma acidophilum [TaxId:2303] [226113] (2 PDB entries)
  8. 2890859Domain d3nglc1: 3ngl C:2-115 [213937]
    Other proteins in same PDB: d3ngla2, d3nglc2
    automated match to d1a4ia2
    complexed with nap

Details for d3nglc1

PDB Entry: 3ngl (more details), 2.4 Å

PDB Description: crystal structure of bifunctional 5,10-methylenetetrahydrofolate dehydrogenase / cyclohydrolase from thermoplasma acidophilum
PDB Compounds: (C:) Bifunctional protein folD

SCOPe Domain Sequences for d3nglc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nglc1 c.58.1.0 (C:2-115) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
kilrgeeiaekkaenlhgiiersglepslkliqigdneaasiyarakirrgkkigiavdl
ekyddismkdllkriddlakdpqingimienplpkgfdyyeivrnipyykdvda

SCOPe Domain Coordinates for d3nglc1:

Click to download the PDB-style file with coordinates for d3nglc1.
(The format of our PDB-style files is described here.)

Timeline for d3nglc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nglc2