Lineage for d3ngbc2 (3ngb C:108-216)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756877Domain d3ngbc2: 3ngb C:108-216 [213927]
    automated match to d1z3gl2
    complexed with bgc, nag, trs

Details for d3ngbc2

PDB Entry: 3ngb (more details), 2.68 Å

PDB Description: crystal structure of broadly and potently neutralizing antibody vrc01 in complex with hiv-1 gp120
PDB Compounds: (C:) Antigen binding fragment of light chain: Antibody VRC01

SCOPe Domain Sequences for d3ngbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ngbc2 b.1.1.0 (C:108-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvte
qdskdstyslsstltlskadyekhkvyacevthqglrspvtksfnrgec

SCOPe Domain Coordinates for d3ngbc2:

Click to download the PDB-style file with coordinates for d3ngbc2.
(The format of our PDB-style files is described here.)

Timeline for d3ngbc2: