Lineage for d3ng0a2 (3ng0 A:104-473)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214217Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2214218Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2214486Family d.128.1.0: automated matches [227250] (1 protein)
    not a true family
  6. 2214487Protein automated matches [227028] (5 species)
    not a true protein
  7. 2214640Species Synechocystis sp. [TaxId:1148] [226157] (1 PDB entry)
  8. 2214641Domain d3ng0a2: 3ng0 A:104-473 [213925]
    Other proteins in same PDB: d3ng0a1
    automated match to d1f52a2
    complexed with anp, mn

Details for d3ng0a2

PDB Entry: 3ng0 (more details), 2.8 Å

PDB Description: Crystal Structure of Glutamine Synthetase from Synechocystis sp. PCC 6803
PDB Compounds: (A:) glutamine synthetase

SCOPe Domain Sequences for d3ng0a2:

Sequence, based on SEQRES records: (download)

>d3ng0a2 d.128.1.0 (A:104-473) automated matches {Synechocystis sp. [TaxId: 1148]}
nrdprtiaakaaeylrgtgiadtvyfgpeaefflfddirfgqtenssyyfadsvegrwnt
greeeggnlgykpgykqgyfpvaptdtaqdirtemlltmaafgvpiekhhhevasggqne
lgikfdklvnsadnlmiykyviknvakkygktvtfmpkpifndngsgmhvhqslwkdgqp
lfagdkyagfsqmglwyiggilkhapallaftnpttnsykrlvpgfeapvnlaysqgnrs
asvriplsggnpkakrlefrcpdatsnpylafaamlcagidgiknqidpgepldvdiydl
speelakipstpgsleaalealekdhefltgtgvfspdfveswieykldnevnpmrlrph
pyefslyydc

Sequence, based on observed residues (ATOM records): (download)

>d3ng0a2 d.128.1.0 (A:104-473) automated matches {Synechocystis sp. [TaxId: 1148]}
nrdprtiaakaaeylrgtgiadtvyfgpeaefflfddirfgqtenssyyfadsvegrwnt
greeeggnlgykpgykqgyfpvaptdtaqdirtemlltmaafgvpiekhhhevasggqne
lgikfdklvnsadnlmiykyviknvakkygktvtfmpkpifndngsgmhvhqslwkdgqp
lfagdkyagfsqmglwyiggilkhapallaftnpttnsykrlvpgfeapvnlaysqgnrs
asvriplsggnpkakrlefrcpdatsnpylafaamlcagidgiknqidpgepldvdiela
kipstpgsleaalealekdhefltgtgvfspdfveswieykldnevnpmrlrphpyefsl
yydc

SCOPe Domain Coordinates for d3ng0a2:

Click to download the PDB-style file with coordinates for d3ng0a2.
(The format of our PDB-style files is described here.)

Timeline for d3ng0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ng0a1