SCOPe 2.04: Domain d3nfpb2: 3nfp B:107-212

Lineage for d3nfpb2 (3nfp B:107-212)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d3nfpb2: 3nfp B:107-212 [213918]
   Other proteins in same PDB: d3nfpb1, d3nfpi1, d3nfpi2, d3nfpk1, d3nfpk2, d3nfpl1
   automated match to d3fcta2

Details for d3nfpb2

PDB Entry: 3nfp, 2.86 Å

PDB Description: Crystal structure of the Fab fragment of therapeutic antibody daclizumab in complex with IL-2Ra (CD25) ectodomain

PDB Compounds: (B:) Light chain of Fab fragment of daclizumab

SCOPe Domain Sequences for d3nfpb2:

Sequence; same for both SEQRES and ATOM records:

>d3nfpb2 b.1.1.2 (B:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d3nfpb2:

• d3nfpb2 first appeared in SCOPe 2.03
  
• d3nfpb2 appears in SCOPe 2.05
  
• d3nfpb2 appears in the current release, SCOPe 2.08