SCOPe 2.03: Domain d3nfpb1: 3nfp B:1-106

Lineage for d3nfpb1 (3nfp B:1-106)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d3nfpb1: 3nfp B:1-106 [213917]
   Other proteins in same PDB: d3nfpb2, d3nfpl2
   automated match to d3fcta1

Details for d3nfpb1

PDB Entry: 3nfp, 2.86 Å

PDB Description: Crystal structure of the Fab fragment of therapeutic antibody daclizumab in complex with IL-2Ra (CD25) ectodomain

PDB Compounds: (B:) Light chain of Fab fragment of daclizumab

SCOPe Domain Sequences for d3nfpb1:

Sequence; same for both SEQRES and ATOM records:

>d3nfpb1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspstlsasvgdrvtitcsasssisymhwyqqkpgkapklliyttsnlasgvpar
fsgsgsgteftltisslqpddfatyychqrstypltfgqgtkvevk

Timeline for d3nfpb1:

• d3nfpb1 is new in SCOPe 2.03-stable
  
• d3nfpb1 appears in SCOPe 2.04
  
• d3nfpb1 appears in the current release, SCOPe 2.08