Lineage for d3nfpb1 (3nfp B:1-106)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2356832Domain d3nfpb1: 3nfp B:1-106 [213917]
    Other proteins in same PDB: d3nfpb2, d3nfpi1, d3nfpi2, d3nfpk1, d3nfpk2, d3nfpl2
    automated match to d3fcta1

Details for d3nfpb1

PDB Entry: 3nfp (more details), 2.86 Å

PDB Description: Crystal structure of the Fab fragment of therapeutic antibody daclizumab in complex with IL-2Ra (CD25) ectodomain
PDB Compounds: (B:) Light chain of Fab fragment of daclizumab

SCOPe Domain Sequences for d3nfpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nfpb1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspstlsasvgdrvtitcsasssisymhwyqqkpgkapklliyttsnlasgvpar
fsgsgsgteftltisslqpddfatyychqrstypltfgqgtkvevk

SCOPe Domain Coordinates for d3nfpb1:

Click to download the PDB-style file with coordinates for d3nfpb1.
(The format of our PDB-style files is described here.)

Timeline for d3nfpb1: