Class a: All alpha proteins [46456] (285 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (18 species) not a true protein |
Species Mycobacterium thermoresistibile [TaxId:1797] [225913] (2 PDB entries) |
Domain d3nf4b2: 3nf4 B:233-382 [213916] Other proteins in same PDB: d3nf4a1, d3nf4b1 automated match to d1ukwa1 complexed with fad, na |
PDB Entry: 3nf4 (more details), 2.35 Å
SCOPe Domain Sequences for d3nf4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nf4b2 a.29.3.0 (B:233-382) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]} gqglqiafsaldsgrlgiaavatglaqaaldeavayanertafgrkiidhqglgflladm aaavataratyldaarrrdqgrpysqqasiakltatdaamkvttdavqvfggvgytrdyr verymreakimqifegtnqiqrlviarglt
Timeline for d3nf4b2: