Lineage for d3nf4b2 (3nf4 B:233-382)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708620Species Mycobacterium thermoresistibile [TaxId:1797] [225913] (2 PDB entries)
  8. 2708626Domain d3nf4b2: 3nf4 B:233-382 [213916]
    Other proteins in same PDB: d3nf4a1, d3nf4b1
    automated match to d1ukwa1
    complexed with fad, na

Details for d3nf4b2

PDB Entry: 3nf4 (more details), 2.35 Å

PDB Description: crystal structure of acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to flavin adenine dinucleotide
PDB Compounds: (B:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d3nf4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nf4b2 a.29.3.0 (B:233-382) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
gqglqiafsaldsgrlgiaavatglaqaaldeavayanertafgrkiidhqglgflladm
aaavataratyldaarrrdqgrpysqqasiakltatdaamkvttdavqvfggvgytrdyr
verymreakimqifegtnqiqrlviarglt

SCOPe Domain Coordinates for d3nf4b2:

Click to download the PDB-style file with coordinates for d3nf4b2.
(The format of our PDB-style files is described here.)

Timeline for d3nf4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nf4b1