SCOPe 2.06: Domain d3nf4b1: 3nf4 B:5-232

Lineage for d3nf4b1 (3nf4 B:5-232)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (25 species)
   not a true protein

7. Species Mycobacterium thermoresistibile [TaxId:1797] [225912] (2 PDB entries)

8. Domain d3nf4b1: 3nf4 B:5-232 [213915]
   Other proteins in same PDB: d3nf4a2, d3nf4b2
   automated match to d1ukwa2
   complexed with fad, na

Details for d3nf4b1

PDB Entry: 3nf4, 2.35 Å

PDB Description: crystal structure of acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to flavin adenine dinucleotide

PDB Compounds: (B:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d3nf4b1:

Sequence, based on SEQRES records:

>d3nf4b1 e.6.1.0 (B:5-232) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
mavdrllpsqeaaelieltreiadkvldpivdrhekdetypegvfeqlgaagllslpqpe
ewggggqpyevylqvleeiaarwasvavavsvhslsshpllvfgteeqkkrwlpgmlsge
qigayslsepqagsdaaalrcaatptdggyvingskswithggkadfytlfartgegsrg
vscflvpadqpglsfgkpeekmglhavpttsafydnaridadrrigee

Sequence, based on observed residues (ATOM records):

>d3nf4b1 e.6.1.0 (B:5-232) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
mavdrllpsqeaaelieltreiadkvldpivdrhekdetypegvfeqlgaagllslpqpe
ewggggqpyevylqvleeiaarwasvavavsvhslsshpllvfgteeqkkrwlpgmlsge
qigayslseprcaatptdggyvingskswithggkadfytlfartgsrgvscflvpadqp
glsfgkpeekmglhavpttsafydnaridadrrigee

Timeline for d3nf4b1:

• d3nf4b1 first appeared in SCOPe 2.03
  
• d3nf4b1 appears in SCOPe 2.05
  
• d3nf4b1 appears in SCOPe 2.07
  
• d3nf4b1 appears in the current release, SCOPe 2.08