Lineage for d3nf4a2 (3nf4 A:233-382)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731940Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1732074Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 1732075Protein automated matches [226935] (21 species)
    not a true protein
  7. 1732188Species Mycobacterium thermoresistibile [TaxId:1797] [225913] (2 PDB entries)
  8. 1732193Domain d3nf4a2: 3nf4 A:233-382 [213914]
    Other proteins in same PDB: d3nf4a1, d3nf4b1
    automated match to d1ukwa1
    complexed with fad, na

Details for d3nf4a2

PDB Entry: 3nf4 (more details), 2.35 Å

PDB Description: crystal structure of acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to flavin adenine dinucleotide
PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d3nf4a2:

Sequence, based on SEQRES records: (download)

>d3nf4a2 a.29.3.0 (A:233-382) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
gqglqiafsaldsgrlgiaavatglaqaaldeavayanertafgrkiidhqglgflladm
aaavataratyldaarrrdqgrpysqqasiakltatdaamkvttdavqvfggvgytrdyr
verymreakimqifegtnqiqrlviarglt

Sequence, based on observed residues (ATOM records): (download)

>d3nf4a2 a.29.3.0 (A:233-382) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
gqglqiafsaldsgrlgiaavatglaqaaldeavayanekiidhglgflladmaaavata
ratyldaarrrdqgrpysqqasiakltatdaamkvttdavqvfggvgytrdyrverymre
akimqifegtnqiqrlviarglt

SCOPe Domain Coordinates for d3nf4a2:

Click to download the PDB-style file with coordinates for d3nf4a2.
(The format of our PDB-style files is described here.)

Timeline for d3nf4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nf4a1