SCOPe 2.06: Domain d3nevb_: 3nev B:

Lineage for d3nevb_ (3nev B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (75 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [226105] (8 PDB entries)

8. Domain d3nevb_: 3nev B: [213910]
   automated match to d3eb2a_
   complexed with edo, rsh

Details for d3nevb_

PDB Entry: 3nev, 2.19 Å

PDB Description: Crystal structure of YagE, a prophage protein from E. coli K12 in complex with KDGal

PDB Compounds: (B:) Uncharacterized protein yagE

SCOPe Domain Sequences for d3nevb_:

Sequence; same for both SEQRES and ATOM records:

>d3nevb_ c.1.10.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alftgiippvstiftadgqldkpgtaaliddlikagvdglfflgsggefsqlgaeerkai
arfaidhvdrrvpvligtggtnaretielsqhaqqagadgivvinpyywkvseanliryf
eqvadsvtlpvmlynfpaltgqdltpalvktladsrsniigikdtidsvahlrsmihtvk
gahphftvlcgyddhlfntlllggdgaisasgnfapqvsvnllkawrdgdvakaagyhqt
llqipqmyqldtpfvnvikeaivlcgrpvsthvlppaspldeprkaqlktllqqlklc

Timeline for d3nevb_:

• d3nevb_ first appeared in SCOPe 2.03
  
• d3nevb_ appears in SCOPe 2.05
  
• d3nevb_ appears in SCOPe 2.07
  
• d3nevb_ appears in the current release, SCOPe 2.08