![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
![]() | Protein automated matches [190115] (94 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [226105] (8 PDB entries) |
![]() | Domain d3nevb_: 3nev B: [213910] automated match to d3eb2a_ complexed with edo, rsh |
PDB Entry: 3nev (more details), 2.19 Å
SCOPe Domain Sequences for d3nevb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nevb_ c.1.10.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} alftgiippvstiftadgqldkpgtaaliddlikagvdglfflgsggefsqlgaeerkai arfaidhvdrrvpvligtggtnaretielsqhaqqagadgivvinpyywkvseanliryf eqvadsvtlpvmlynfpaltgqdltpalvktladsrsniigikdtidsvahlrsmihtvk gahphftvlcgyddhlfntlllggdgaisasgnfapqvsvnllkawrdgdvakaagyhqt llqipqmyqldtpfvnvikeaivlcgrpvsthvlppaspldeprkaqlktllqqlklc
Timeline for d3nevb_: