Lineage for d1dqqb2 (1dqq B:114-221)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8513Species Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain [49096] (3 PDB entries)
  8. 8515Domain d1dqqb2: 1dqq B:114-221 [21391]
    Other proteins in same PDB: d1dqqa1, d1dqqb1, d1dqqc1, d1dqqd1

Details for d1dqqb2

PDB Entry: 1dqq (more details), 1.8 Å

PDB Description: crystal structure of anti-lysozyme antibody hyhel-63

SCOP Domain Sequences for d1dqqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqqb2 b.1.1.2 (B:114-221) Immunoglobulin (constant domains of L and H chains) {Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkki

SCOP Domain Coordinates for d1dqqb2:

Click to download the PDB-style file with coordinates for d1dqqb2.
(The format of our PDB-style files is described here.)

Timeline for d1dqqb2: