SCOPe 2.04: Domain d3nepx1: 3nep X:22-163

Lineage for d3nepx1 (3nep X:22-163)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Salinibacter ruber [TaxId:309807] [225984] (1 PDB entry)

8. Domain d3nepx1: 3nep X:22-163 [213907]
   Other proteins in same PDB: d3nepx2
   automated match to d1gv0a1

Details for d3nepx1

PDB Entry: 3nep, 1.55 Å

PDB Description: 1.55A resolution structure of malate dehydrogenase from Salinibacter ruber

PDB Compounds: (X:) malate dehydrogenase

SCOPe Domain Sequences for d3nepx1:

Sequence, based on SEQRES records:

>d3nepx1 c.2.1.0 (X:22-163) automated matches {Salinibacter ruber [TaxId: 309807]}
mkvtvigagnvgatvaecvarqdvakevvmvdikdgmpqgkaldmresspihgfdtrvtg
tndygptedsdvciitaglprspgmsrddllaknteivggvteqfvegspdstiivvanp
ldvmtyvayeasgfptnrvmgm

Sequence, based on observed residues (ATOM records):

>d3nepx1 c.2.1.0 (X:22-163) automated matches {Salinibacter ruber [TaxId: 309807]}
mkvtvigagnvgatvaecvarqdvakevvmvdikdgmpqgkaldmresspihgfdtrvtg
tndygptedsdvciitaglrddllaknteivggvteqfvegspdstiivvanpldvmtyv
ayeasgfptnrvmgm

Timeline for d3nepx1:

• d3nepx1 first appeared in SCOPe 2.03
  
• d3nepx1 appears in SCOPe 2.05
  
• d3nepx1 appears in the current release, SCOPe 2.08