Lineage for d3nenb2 (3nen B:103-316,B:317-438)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532556Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2532557Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2532945Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2532946Protein automated matches [226887] (17 species)
    not a true protein
  7. 2533052Species Thermococcus kodakarensis [TaxId:311400] [226766] (3 PDB entries)
  8. 2533058Domain d3nenb2: 3nen B:103-316,B:317-438 [213906]
    Other proteins in same PDB: d3nena1, d3nenb1
    automated match to d1c0aa3

Details for d3nenb2

PDB Entry: 3nen (more details), 2.4 Å

PDB Description: Unliganded aspartyl-tRNA synthetase from thermococcus kodakarensis
PDB Compounds: (B:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d3nenb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nenb2 d.104.1.0 (B:103-316,B:317-438) automated matches {Thermococcus kodakarensis [TaxId: 311400]}
tplpldptgkvkaeldtrldnrfmdlrrpevmaifkirssvfkavrdffhengfieihtp
kiiatateggtelfpmkyfeedaflaqspqlykqimmasgldrvyeiapifraeehnttr
hlneawsidsemafiedeeevmsflerlvahainyvrehnakeldilnfeleepklpfpr
vsydkaleilgdlgkeipwgedidtegerllgkyXmmenenaplyflyqypseakpfyim
kydnkpeicrafdleyrgveissggqrehrhdilveqikekglnpesfefylkafrygmp
phggfglgaerlikqmldlpnirevilfprdrrrltp

SCOPe Domain Coordinates for d3nenb2:

Click to download the PDB-style file with coordinates for d3nenb2.
(The format of our PDB-style files is described here.)

Timeline for d3nenb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nenb1