Lineage for d3nema2 (3nem A:103-316,A:317-438)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663707Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1663708Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1664082Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 1664083Protein automated matches [226887] (8 species)
    not a true protein
  7. 1664135Species Thermococcus kodakarensis [TaxId:311400] [226766] (3 PDB entries)
  8. 1664136Domain d3nema2: 3nem A:103-316,A:317-438 [213900]
    Other proteins in same PDB: d3nema1, d3nemb1
    automated match to d1c0aa3
    protein/RNA complex; complexed with amo, atp, mg

Details for d3nema2

PDB Entry: 3nem (more details), 1.89 Å

PDB Description: Aspartyl-tRNA synthetase complexed with aspartyl adenylate
PDB Compounds: (A:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d3nema2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nema2 d.104.1.0 (A:103-316,A:317-438) automated matches {Thermococcus kodakarensis [TaxId: 311400]}
tplpldptgkvkaeldtrldnrfmdlrrpevmaifkirssvfkavrdffhengfieihtp
kiiatateggtelfpmkyfeedaflaqspqlykqimmasgldrvyeiapifraeehnttr
hlneawsidsemafiedeeevmsflerlvahainyvrehnakeldilnfeleepklpfpr
vsydkaleilgdlgkeipwgedidtegerllgkyXmmenenaplyflyqypseakpfyim
kydnkpeicrafdleyrgveissggqrehrhdilveqikekglnpesfefylkafrygmp
phggfglgaerlikqmldlpnirevilfprdrrrltp

SCOPe Domain Coordinates for d3nema2:

Click to download the PDB-style file with coordinates for d3nema2.
(The format of our PDB-style files is described here.)

Timeline for d3nema2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nema1