Lineage for d3nelb1 (3nel B:1-102)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790411Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2790412Protein automated matches [190576] (52 species)
    not a true protein
  7. 2790703Species Thermococcus kodakarensis [TaxId:311400] [225945] (3 PDB entries)
  8. 2790707Domain d3nelb1: 3nel B:1-102 [213897]
    Other proteins in same PDB: d3nela2, d3nelb2
    automated match to d1c0aa1
    protein/RNA complex; complexed with asp

Details for d3nelb1

PDB Entry: 3nel (more details), 1.95 Å

PDB Description: Aspartyl-tRNA synthetase complexed with aspartic acid
PDB Compounds: (B:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d3nelb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nelb1 b.40.4.0 (B:1-102) automated matches {Thermococcus kodakarensis [TaxId: 311400]}
myrthysseiteelngqkvkvagwvwevkdlggikflwirdrdgivqitapkkkvdpelf
klipklrsedvvavegvvnftpkaklgfeilpekivvlnrae

SCOPe Domain Coordinates for d3nelb1:

Click to download the PDB-style file with coordinates for d3nelb1.
(The format of our PDB-style files is described here.)

Timeline for d3nelb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nelb2