Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
Family d.150.1.0: automated matches [191589] (1 protein) not a true family |
Protein automated matches [191061] (11 species) not a true protein |
Species Corynebacterium ammoniagenes [TaxId:1697] [196390] (2 PDB entries) |
Domain d3ne9b_: 3ne9 B: [213891] automated match to d3nfdb_ complexed with so4 |
PDB Entry: 3ne9 (more details), 2.5 Å
SCOPe Domain Sequences for d3ne9b_:
Sequence, based on SEQRES records: (download)
>d3ne9b_ d.150.1.0 (B:) automated matches {Corynebacterium ammoniagenes [TaxId: 1697]} reamtvgvdlvhipgfaeqlsrpgstfeqvfsplerrhaqtrrsaaadatnsslagsrte hlagrwaakeafikawsqaiygkppviepdlvnfaeievlpdrwgrvalqlkgevaaklq esigdvelalsishdgdyatalcllryqr
>d3ne9b_ d.150.1.0 (B:) automated matches {Corynebacterium ammoniagenes [TaxId: 1697]} reamtvgvdlvhipgfaeqlsrpgstfeqvfsplerrhaqtrrsgsrtehlagrwaakea fikawsqaiygkppviepdlvnfaeievlpdrwgrvalqlkgevaaklqesigdvelals ishdgdyatalcllryqr
Timeline for d3ne9b_: