SCOPe 2.07: Domain d3ne9a_: 3ne9 A:

Lineage for d3ne9a_ (3ne9 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
   beta-alpha(3)-beta(2) motif

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families)
   possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)

5. Family d.150.1.0: automated matches [191589] (1 protein)
   not a true family

6. Protein automated matches [191061] (11 species)
   not a true protein

7. Species Corynebacterium ammoniagenes [TaxId:1697] [196390] (2 PDB entries)

8. Domain d3ne9a_: 3ne9 A: [213890]
   automated match to d3nfdb_
   complexed with so4

Details for d3ne9a_

PDB Entry: 3ne9, 2.5 Å

PDB Description: chronobacterium ammoiniagenes apo-acps structure

PDB Compounds: (A:) Phosphopantetheine protein transferase, Ppt1p

SCOPe Domain Sequences for d3ne9a_:

Sequence, based on SEQRES records:

>d3ne9a_ d.150.1.0 (A:) automated matches {Corynebacterium ammoniagenes [TaxId: 1697]}
reamtvgvdlvhipgfaeqlsrpgstfeqvfsplerrhaqtrrsaaadatnsslagsrte
hlagrwaakeafikawsqaiygkppviepdlvnfaeievlpdrwgrvalqlkgevaaklq
esigdvelalsishdgdyatalcllryqr

Sequence, based on observed residues (ATOM records):

>d3ne9a_ d.150.1.0 (A:) automated matches {Corynebacterium ammoniagenes [TaxId: 1697]}
reamtvgvdlvhipgfaeqlsrpgstfeqvfsplerrhaqtrragsrtehlagrwaakea
fikawsqaiygkppviepdlvnfaeievlpdrwgrvalqlkgevaaklqesigdvelals
ishdgdyatalcllryqr

Timeline for d3ne9a_:

• d3ne9a_ first appeared in SCOPe 2.03
  
• d3ne9a_ appears in SCOPe 2.06
  
• d3ne9a_ appears in the current release, SCOPe 2.08