Lineage for d1cl7.1 (1cl7 H:114-128,I:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655658Domain d1cl7.1: 1cl7 H:114-128,I: [21389]
    Other proteins in same PDB: d1cl7h1, d1cl7l1, d1cl7l2
    part of Fab 1696 against HIV-1 protease

Details for d1cl7.1

PDB Entry: 1cl7 (more details), 3 Å

PDB Description: anti hiv1 protease fab
PDB Compounds: (H:) PROTEIN (IGG1 ANTIBODY 1696 (variable heavy chain)), (I:) PROTEIN (IGG1 ANTIBODY 1696 (constant heavy chain))

SCOP Domain Sequences for d1cl7.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1cl7.1 b.1.1.2 (H:114-128,I:) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsXsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
sssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1cl7.1:

Click to download the PDB-style file with coordinates for d1cl7.1.
(The format of our PDB-style files is described here.)

Timeline for d1cl7.1: