SCOP 1.71: Domain d1cl7.1: 1cl7 H:114-128,I:

Lineage for d1cl7.1 (1cl7 H:114-128,I:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)

8. Domain d1cl7.1: 1cl7 H:114-128,I: [21389]
   Other proteins in same PDB: d1cl7h1, d1cl7l1, d1cl7l2
   part of Fab 1696 against HIV-1 protease

Details for d1cl7.1

PDB Entry: 1cl7, 3 Å

PDB Description: anti hiv1 protease fab

SCOP Domain Sequences for d1cl7.1:

Sequence; same for both SEQRES and ATOM records:

>g1cl7.1 b.1.1.2 (H:114-128,I:) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsXsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
sssvtvpssprpsetvtcnvahpasstkvdkkivprdc

Timeline for d1cl7.1:

• d1cl7.1 first appeared (with stable ids) in SCOP 1.55
  
• d1cl7.1 appears in SCOP 1.69
  
• d1cl7.1 appears in SCOP 1.73
  
• d1cl7.1 appears in the current release, SCOPe 2.08