Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries) |
Domain d1cl7.1: 1cl7 H:114-128,I: [21389] Other proteins in same PDB: d1cl7h1, d1cl7l1, d1cl7l2 part of Fab 1696 against HIV-1 protease |
PDB Entry: 1cl7 (more details), 3 Å
SCOP Domain Sequences for d1cl7.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1cl7.1 b.1.1.2 (H:114-128,I:) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttppsvyplapgsXsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl sssvtvpssprpsetvtcnvahpasstkvdkkivprdc
Timeline for d1cl7.1: