Lineage for d1cl7.1 (1cl7 H:114-128,I:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159508Species Fab 1696, (mouse), kappa L chain [49095] (1 PDB entry)
  8. 159509Domain d1cl7.1: 1cl7 H:114-128,I: [21389]
    Other proteins in same PDB: d1cl7h1, d1cl7l1

Details for d1cl7.1

PDB Entry: 1cl7 (more details), 3 Å

PDB Description: anti hiv1 protease fab

SCOP Domain Sequences for d1cl7.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1cl7.1 b.1.1.2 (H:114-128,I:) Immunoglobulin (constant domains of L and H chains) {Fab 1696, (mouse), kappa L chain}
akttppsvyplapgsXsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
sssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1cl7.1:

Click to download the PDB-style file with coordinates for d1cl7.1.
(The format of our PDB-style files is described here.)

Timeline for d1cl7.1: