Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species Fab 1696, (mouse), kappa L chain [49095] (1 PDB entry) |
Domain d1cl7.1: 1cl7 H:114-128,I: [21389] Other proteins in same PDB: d1cl7h1, d1cl7l1 |
PDB Entry: 1cl7 (more details), 3 Å
SCOP Domain Sequences for d1cl7.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1cl7.1 b.1.1.2 (H:114-128,I:) Immunoglobulin (constant domains of L and H chains) {Fab 1696, (mouse), kappa L chain} akttppsvyplapgsXsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl sssvtvpssprpsetvtcnvahpasstkvdkkivprdc
Timeline for d1cl7.1: