SCOPe 2.03: Domain d3ndpa1: 3ndp A:5-125,A:175-231

Lineage for d3ndpa1 (3ndp A:5-125,A:175-231)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (58 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (75 PDB entries)

8. Domain d3ndpa1: 3ndp A:5-125,A:175-231 [213885]
   Other proteins in same PDB: d3ndpa2, d3ndpb2
   automated match to d2ak3a1
   complexed with so4

Details for d3ndpa1

PDB Entry: 3ndp, 2.3 Å

PDB Description: crystal structure of human ak4(l171p)

PDB Compounds: (A:) Adenylate kinase isoenzyme 4

SCOPe Domain Sequences for d3ndpa1:

Sequence; same for both SEQRES and ATOM records:

>d3ndpa1 c.37.1.0 (A:5-125,A:175-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
llravilgppgsgkgtvcqriaqnfglqhlssghflrenikastevgemakqyieksllv
pdhvitrlmmselenrrgqhwlldgfprtlgqaealdkicevdlvislnipfetlkdrls
rXkdvakpvielyksrgvlhqfsgtetnkiwpyvytlfsnkitpiqskeaylehhhhhh

Timeline for d3ndpa1:

• d3ndpa1 is new in SCOPe 2.03-stable
  
• d3ndpa1 appears in SCOPe 2.04
  
• d3ndpa1 appears in the current release, SCOPe 2.08