SCOPe 2.03: Domain d3ndnc_: 3ndn C:

Lineage for d3ndnc_ (3ndn C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (66 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [225404] (11 PDB entries)

8. Domain d3ndnc_: 3ndn C: [213883]
   automated match to d1e5ea_

Details for d3ndnc_

PDB Entry: 3ndn, 1.85 Å

PDB Description: crystal structure of o-succinylhomoserine sulfhydrylase from mycobacterium tuberculosis covalently bound to pyridoxal-5-phosphate

PDB Compounds: (C:) O-succinylhomoserine sulfhydrylase

SCOPe Domain Sequences for d3ndnc_:

Sequence; same for both SEQRES and ATOM records:

>d3ndnc_ c.67.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
svrtpkalpdgvsqatvgvrggmlrsgfeetaeamyltsgyvygsaavaeksfageldhy
vysrygnptvsvfeerlrliegapaafatasgmaavftslgallgagdrlvaarslfgsc
fvvcseilprwgvqtvfvdgddlsqweralsvptqavffetpsnpmqslvdiaavtelah
aagakvvldnvfatpllqqgfplgvdvvvysgtkhidgqgrvlggailgdreyidgpvqk
lmrhtgpamsafnawvllkgletlairvqhsnasaqriaeflnghpsvrwvrypylpshp
qydlakrqmsgggtvvtfaldcpedvakqrafevldkmrlidisnnlgdakslvthpatt
thramgpegraaiglgdgvvrisvgledtddliadidrals

Timeline for d3ndnc_:

• d3ndnc_ is new in SCOPe 2.03-stable
  
• d3ndnc_ appears in SCOPe 2.04
  
• d3ndnc_ appears in the current release, SCOPe 2.08