Lineage for d1cl7l2 (1cl7 L:108-211)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365639Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 365760Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)
  8. 366008Domain d1cl7l2: 1cl7 L:108-211 [21388]
    Other proteins in same PDB: d1cl7.1, d1cl7h1, d1cl7l1
    part of Fab 1696 against HIV-1 protease

Details for d1cl7l2

PDB Entry: 1cl7 (more details), 3 Å

PDB Description: anti hiv1 protease fab

SCOP Domain Sequences for d1cl7l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cl7l2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1cl7l2:

Click to download the PDB-style file with coordinates for d1cl7l2.
(The format of our PDB-style files is described here.)

Timeline for d1cl7l2: