SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1cl7l2 (1cl7 L:108-211)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2023413Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2023645Species Mouse (Mus musculus) [TaxId:10090] [88567] (355 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 2023960Domain d1cl7l2: 1cl7 L:108-211 [21388]
    Other proteins in same PDB: d1cl7.1, d1cl7h1, d1cl7l1
    part of Fab 1696 against HIV-1 protease

Details for d1cl7l2

PDB Entry: 1cl7 (more details), 3 Å

PDB Description: anti hiv1 protease fab
PDB Compounds: (L:) PROTEIN (IGG1 ANTIBODY 1696 (light chain))

SCOPe Domain Sequences for d1cl7l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cl7l2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d1cl7l2:

Click to download the PDB-style file with coordinates for d1cl7l2.
(The format of our PDB-style files is described here.)

Timeline for d1cl7l2: